Anti-HOXA5 Picoband antibody

Catalog number:A04018-2
Name:Anti-HOXA5 Picoband antibody
Size:100µg/vial
Supplier:boster
Price:390.00
  Buy   
Clonality:Polyclonal
Sample Size Available:30ug for $99, contact us for details
Immunogen:A synthetic peptide corresponding to a sequence of human HOXA5 (AQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEK).
Form:Lyophilized
Purification:NA
Storage & Transport Conditions:At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Cross-reactivity:No cross reactivity with other proteins.
Ig Type:N/A
Reconstitution:Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Application Details:Western blot, 0.1-0.5µg/ml
Applications:WB
Reactivity:Human, Mouse, Rat
Product Datasheet:www.bosterbio.com/datasheet.php?sku=A04018-2
Description:This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
Properties:If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation:anticorps
Loading