| Clonality: |
Polyclonal |
| Sample Size Available: |
30ug for $99, contact us for details |
| Immunogen: |
A synthetic peptide corresponding to a sequence at the C-terminus of human HOXA1 (202-243aa AQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTE), different from the related mouse and rat sequences by one amino acid. |
| Form: |
Lyophilized |
| Purification: |
Immunogen affinity purified. |
| Storage & Transport Conditions: |
At -20°C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing. |
| Cross-reactivity: |
No cross reactivity with other proteins. |
| Ig Type: |
N/A |
| Reconstitution: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Application Details: |
Western blot, 0.1-0.5µg/ml, Human |
| Applications: |
WB |
| Reactivity: |
Human |
| Product Datasheet: |
www.bosterbio.com/datasheet.php?sku=A03416 |
| Description: |
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. |
| Properties: |
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. |
| French translation: |
anticorps |