| Product Type: | Proteins |
|---|
| Product Subtype: | Blocking Peptides |
|---|
| Research Area: | Differentiation & Development |
|---|
| Tag/Conjugate: | KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE |
|---|
| Type1: | Synthetic |
|---|
| Form & Buffer: | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
|---|
| Storage: | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
| Applications: | WB, IHC |
|---|
| Shipping Info: | Blue Ice |
|---|
| Test: | You can block the antibody by the specific target amino acid sequence of peptide. |
|---|
| Properties: | blocking peptide |
|---|
| Description: | Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs. |
|---|