HOXA5 Blocking Peptide

Catalog number: 33R-9573
Name: HOXA5 Blocking Peptide
Size: 100 ug
Supplier: fitzgerald
Price: 280.00
  Buy   
Product Type: Proteins
Product Subtype: Blocking Peptides
Research Area: Signal Transduction
Tag/Conjugate: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Type1: Synthetic
Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage: Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications: WB, IHC
Shipping Info: Blue Ice
Test: You can block the antibody by the specific target amino acid sequence of peptide.
Properties: blocking peptide
Description: Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Loading