| Category: |
Proteins |
| Antibody Subtype: |
Blocking Peptides |
| Area of research: |
Differentiation & Development |
| Residues: |
KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE |
| Type of protein: |
Synthetic |
| Form & Buffer: |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
| Storage: |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
| Shipping conditions: |
Blue Ice |
| Tested for: |
WB; IHC |
| Test: |
You can block the antibody by the specific target amino acid sequence of peptide. |
| Properties: |
blocking peptide |
| Description: |
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs. |