HOXA5 Blocking Peptide

Catalog number: 33R-3010
Name: HOXA5 Blocking Peptide
Size: 100 µg
Supplier: fitzgerald
Price: 210.00
  Buy   
Category: Proteins
Antibody Subtype: Blocking Peptides
Area of research: Signal Transduction
Residues: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG
Type of protein: Synthetic
Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage: Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Shipping conditions: Blue Ice
Tested for: WB; IHC
Test: You can block the antibody by the specific target amino acid sequence of peptide.
Properties: blocking peptide
Description: Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Loading