| Catalog number: | 33R-9573 |
|---|---|
| Name: | HOXA5 Blocking Peptide |
| Size: | 100 µg |
| Supplier: | fitzgerald |
| Price: | 210.00 |
| Buy |
| Category: | Proteins |
|---|---|
| Antibody Subtype: | Blocking Peptides |
| Area of research: | Signal Transduction |
| Residues: | VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG |
| Type of protein: | Synthetic |
| Form & Buffer: | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
| Storage: | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
| Shipping conditions: | Blue Ice |
| Tested for: | WB; IHC |
| Test: | You can block the antibody by the specific target amino acid sequence of peptide. |
| Properties: | blocking peptide |
| Description: | Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs. |